Inhibits cell growth by regulating the Tor pathway upstream of the Tsc1-Tsc2 complex and downstream of Akt1. Acts as cell death activator during head development (By similarity).

Belongs to the DDIT4 family.

289 amino acids

MKMEVLSVQNHIQGKFGVNKIKDWPSSGVASTAPHPLEEEEENAVDVNAALDADVVDGHPASVLHMRQHQALNTRSTVPMAPPVAGSGKQSAVAASFDVVNGSSAAYHHAYMTNVLASTAHHPGHGHGPGPSPMPASPLQSTAGARFGAADNMDDVSASAVRDLSQQLQFQLRDAKQRHLACTEVNLPADLTERIAAEIIRMSDREPCGERACTLFIEFESEPNNVRRIASFKVDPDTVSIFELYLTLKQDKSGWTSLLPQFIKNLTRSNTINISPDFTLTKNKLYSSE

31.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chrb using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here