Involved in RNA-mediated post-transcriptional gene silencing (PTGS). Main component of the RNA-induced silencing complex (RISC) that binds to a short guide RNA such as microRNA (miRNA) or small interfering RNA (siRNA). RISC uses the mature miRNA or siRNA as a guide for slicer-directed cleavage of homologous mRNAs to repress gene expression. Associates mainly with siRNAs of 21 nucleotide in length and preferentially recruits small RNAs with a 5' terminal adenosine. Probably involved in antiviral RNA silencing. Associates with siRNA derived from cucumber mosaic virus (CMV). Targeted by turnip yellows virus (TuYV) protein P0 (via F-box-like domain) for probable proteasome degradation and thereby inactivating AGO2 function in RNA silencing. Required to direct NERD-dependent DNA methylation and silencing.

Belongs to the argonaute family. Ago subfamily.

1014 amino acids

MERGGYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRGQGRGEQQDFRSQSQRGPPPGHGGRGTTQFQQPRPQVAPQPSQAPASYAGSVGGVAGRGAWGRKPQVPSDSASPSTSTTVVSEPVRVAEVMNLKPSVQVATSDRKEPMKRPDRGGVVAVRRVNLYVNHYKVNFNPESVIRHYDVEIKGEIPTKKVSRFELAMVRDKVFTDNPDEFPLAMTAYDGQKNIFSAVELPTGSYKVEYPKTEEMRGRSYTFTIKQVNVLKLGDLKEYMTGRSSFNPRDVLQGMDVVMKEHPSKCMITVGKSFFTRETEPDEDFRFGVIAAKGYRHTLKPTAQGLSLCLDYSVLAFRKAMSVIEYLKLYFNWSDMRQFRRRDVEEELIGLKVTVNHRKNKQKLTIVGLSMQNTKDIKFDLIDQEGNEPPRKTSIVEYFRIKYGRHIVHKDIPCLDLGKNGRQNFVPMEFCDLVEGQIYPKDNLDKDSALWLKKLSLVNPQQRQRNIDKMIKARNGPSGGEIIGNFGLKVDTNMTPVEGRVLKAPSLKLAERGRVVREEPNPRQNNQWNLMKKGVTRGSIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKVGGSNVELMDTFSFFKKEDEVMFIGADVNHPAARDKMSPSIVAVVGTLNWPEANRYAARVIAQPHRKEEIQGFGDACLELVKAHVQATGKRPNKIVIFRDGVSDAQFDMVLNVELLDVKLTFEKNGYNPKITVIVAQKRHQTRFFPATNNDGSDKGNVPSGTVVDTKVIHPYEYDFYLCSHHGGIGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRGRMYHEASSREKNFKQPRGASTSAASLASSLSSLTIEDKAIFKLHAELENVMFFV

113.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AGO2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here