Activates the tRNA-splicing ligase complex by facilitating the enzymatic turnover of catalytic subunit RtcB. Acts by promoting the guanylylation of RtcB, a key intermediate step in tRNA ligation. Can also alter the NTP specificity of RtcB such that ATP, dGTP or ITP is used efficiently (By similarity).

Belongs to the archease family.

133 amino acids

MTYEILDHESDIGIMVYGTTYEELFSNAVYAMADLILDVGKLKEKRKMHEIIRGNTPEDIMVNLLSRVLFYVDTYYTLYFRATCKYEDSTLDVYLYGSEIPEEVEYRNVIKAVTYSEIAVKPEDGFARVIFDL

15.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TV0961 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here