Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in embryonic patterning. May be involved in the specification of the spatial patterns of expression of Gsc and other regulatory genes leading to the establishment of the embryonic axis.

Belongs to the Wnt family.

359 amino acids

MNPCQIFASLVMSICCHILSSTAWSVNNFLMTGPKAYLAYTSSVQAGAQSGIEECKHQFAWDRWNCPESALQLSTHKGLRSATRETAFVHAISAAGVMYTLTKNCSMGDFENCGCDDSKIGKMGGRGWVWGGCSDNVNFGDRIAKLFVDALENGHDSRAAVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQTCWMQLADFRDIGSYLKIKHDQARKLEMDKIRMRAGNSADNRGAIADTFSAVARTELIFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNLSQWERRSCRRLCHECGLKVEERRIETVSSCNCKFHWCCTVKCETCTQTVTRYFCAKRHRNRRPHNHSRKRQHTRRG

40.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make wnt8a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here