Ligand for members of the frizzled family of seven transmembrane receptors (By similarity). Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (By similarity). Required for normal embryonic development (By similarity).

Belongs to the Wnt family.

single

123 amino acids

SGSCEVKTCWVAQPDFRSIGDHLKDKYDSASEMVVEKHKEARGWVETLRPKYPLFKPPTDRDLIYYERSPNFCDPNSETGSFGTKDRVCNLTSHGIDGCDLLCCGRGHNTRTEKRKDKCHCVF

14 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make WNT-3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here