May be a minor structural protein present in one or two copies per virion. May play a role in RNA genome packaging (By similarity).

Belongs to the sapovirus VP2 family.

164 amino acids

MSWIAGAMQGAGLLGDLAGTIGQIVLHNKQLNIMNSFNQAQIQLAKDQLKQNQQLANQYYEFNANLPVNQYNSAVSAGFDSVSARQLAGSREVRYLGGQQTPLVHQGQIHQMMFSPKHLMQAQHVVGTFSRGMPGVTPSKGLPRPQGVTAKVPVAGATTTHSKV

17.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ORF2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here