May participate in nuclear egress of viral particles. Plays a role in the dispersal of several host nucleolar proteins including NCL/nucleolin and NPM1. Since deletion of host NCL/nucleolin negatively impact on nuclear egress, UL24 supposedly acts on this process through its effect on host nucleoli (By similarity).

Belongs to the herpesviridae UL24 family.

252 amino acids

MSLTGLPDIRKKIGQFHHLRIYKQILSLQGNFARLNYFLGDVFPANLRSASVSVFFEVRLGPRIPDCIVLLKSVDAKDEFAFHCYFFEFKTTLGKSTMQSVHHNCIHQAQYLQGLRQLHQSISFLDQYLIADEVLWNVVPVICFFRQWGLKLDFFKKFSGKTKRLSFSFICDLFARSQDGAVQSLLSIPNYTNFRRACQKHTDLYRRRYQKASKSVLTKTSGENRSRASRQVAKNAPKNRIRRTAKKDAKRQ

29.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make U49 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here