Plays a role in viral entry into host cells. Forms a pentameric complex at the surface of the viral envelope together with gH, gL, UL130 and UL131. This complex is required for entry in epithelial, endothelial and myeloid host cells (PubMed:23853586, PubMed:17942555). Mechanistically, engages host receptor(s) including neurophilin 2/NRP2 to mediate infection (PubMed:30057110). Contributes to the formation of the complex between UL128, UL130 and gH-gL.

129 amino acids

MRLCRVWLSVCLCAVVLGQCQRETAEKNDYYRVPHYWDACSRALPDQTRYKYVEQLVDLTLNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTNKRTTFNAAGSLAPHARSLEFSVRLFAN

15 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make UL131A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here