Repressor of jasmonate responses. Unable to associate strongly with COI1 in the presence of jasmonoyl-isoleucine (JA-Ile) and is therefore more resistant to JA-medisted-degradation than other TIFY/JAZ proteins. Repress gene expression through direct recruitment of the corepressor TOPLESS to cognate transcription factors.

Belongs to the TIFY/JAZ family.

131 amino acids

MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR

14.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TIFY5A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here