Involved in protein precursor import into chloroplasts. May be part of an intermediate translocation complex acting as a protein-conducting channel at the inner envelope.

527 amino acids

MSSMNFNPFQNWFEKPPNPVPSINFVSLADSFFPKSQSPNFASIGLPKFSKKSPKPETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKENPSTEEIEAEQKWWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYRKEDKDYWRAIPHVPGFDGRPMPRKAIKSKEESDDKFWDFMKQFLFGLWGFRQRPYPPGRPIDVAQAIGYKRLEKRYYDFIMKTGGWWYKDRLGRSRGPCEIITLKTAYGAGIIDRDTFIWGEDMDEWAPIHMVYGLEPAIATWEVRLGAAATAFLHKLQKGIPPWVPLKGREPKTYKQLQKEAIESKKRDMAVLEANGGVWPGVRTPSHALFLWASGSELTTVLESDHMPNKFIPKQLRLELAKVIPGLRPWEVISIEQAMDQISYGGEWYREPLGTYTTGPPYIREWNRSVMRLFRIFYNLSVRVGQKLERTVPGFDTIMDKVQKDYDKRIARRMKRREEELREEDLKHYSGRTDEDEEEEEEEDDDSNSKKD

61.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TIC56 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here