Protein expression services for SIC | Protein SICKLE
Description
Involved in miRNAs and siRNAs biogenesis and thus promotes gene silencing (PubMed:23071326). Modulates auxin (IAA) transport-related developmental programs by regulating protein phosphatase 2A (PP2As)-driven auxin efflux carrier PIN proteins recycling and polarity (PubMed:26888284). Required during development (PubMed:23071326, PubMed:26888284). Necessary for abiotic stress (e.g. chilling and salt) tolerance (PubMed:23071326).
Species
Arabidopsis thaliana
Length
319 amino acids
Sequence
MEDSEKRKQMLKAMRMEAAAQNDDDATTGTETSMSTGHLSNPLAETSNHQQDSFETQRFDYYTDPMAAYSSFKKNKTPKQQYISSPSHQGSSPVPPQFPPSVPPGSLCSEYQAQTNHGGFHAAHYEPRGMAHLSPSHRGPPAGWNNNFRPPPVNHSGPPQWVPRPFPFSQEMPNMGNNRFGGRGSYNNTPPQFSNYGRQNANWGGNTYPNSGRGRSRGRGMNTSFGRDGGRRPMEPGAERFYSNSMAEDPWKHLKPVLWKNCSDASSSSSTGQAWLPKSIAPKKSVTSEATHKTSSNQQSLAEYLAASLDGATCDESSN
Mass
35.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SIC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here