Description
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative (By similarity).
Family
Belongs to the S-100 family.
Sequence
MAAPLDQAIGLLVATFHKYSGKEGDKNSLSKGELKELIQKELTIGPKLKDAEIAGLMEDLDRNKDQEVNFQEYVTFLGALAMIYNEALLQYK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service