Promotes functional expression of homomeric alpha-7 and alpha-8 nicotinic acetylcholine receptors at the cell surface. May also promote functional expression of homomeric serotoninergic 5-HT3 receptors, and of heteromeric acetylcholine receptors alpha-3/beta-2, alpha-3/beta-4, alpha-4/beta-2 and alpha-4/beta-4.

Belongs to the ric-3 family.

367 amino acids

MAYSTVQRVALASGLVLAVSLLLPKAFLSRGKRPEPPPGPEGKLDRFPPMMHHHSAPSDGQTPGARFQRSHLAEAFAKAKGAGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTAEDRNCSTAPPGNAHRKITNFELVQLQEKLKETEEAMEKLINRVGPNGESRAQAVTSDQEKRLLHQLREITRVMKEGKFIDTSPEKEAEEAPYMEDWEGYPEETYPIYDLSDGIKRRQETILVDYPDLKEPSAEEIAEQMGEIEEEGSERLSWDHLPTDPGAQKDNSVAPCDPKPESCSCCVHEEEDPAVLAENAGFSADGYSEQEEATKENLPQDFTNEGLGVSTDNAHVGGMLRKRNPQGFE

40.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ric3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here