Required for the restriction of long-distance movement of the pathogenic tobacco etch virus (TEV) without causing a hypersensitive response or inducing systemic acquired resistance. Seems to not be involved in heat resistance.

Belongs to the small heat shock protein (HSP20) family.

366 amino acids

MAARQQQKGTGFGVQYEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETITKVAYLPETSRTEAAALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEKEALIRKLQEEAKAKEEAEMRKLQEEAKAKEEAAAKKLQEEIEAKEKLEERKLEERRLEERKLEDMKLAEEAKLKKIQERKSVDESGEKEKILKPEVVYTKSGHVATPKPESGSGLKSGFGGVGEVVKSAEEKLGNLVEKEKKMGKGIMEKIRRKEITSEEKKLMMNVGVAALVIFALGAYVSYTFCSSSSSSSSSSPSSSSSSTKPE

41.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RTM2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here