Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases (By similarity).

Belongs to the plant rapid alkalinization factor (RALF) family.

97 amino acids

MEARHMLVTILLLSFVFMNIMKVEAQKVIGYPAIGRDGARGCSPKDPSCPQQPEKPYKRGCEKITRCERDRRKQAHLRNPRKVLDVVAVMAKAKQLY

11.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RALFL2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here