Required for proper folding and/or the stability of a subset of proteins in the endoplasmic reticulum. Aids the autocatalytic processing of PRB1. Component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase GPI14.

Belongs to the PIGX family.

416 amino acids

MVTRHRVTVLYNAPEDIGNHMRQNDTHLTVRGGSGVVLQQRWLLERTGSLDKSFTRITWRPRADLARSLSVIENELSAGFSVYSNSSDVPERFITNPVYNSFHSEKFDIEQYLPPEVDLNLSWNPEDFTYDISVEPTQIQIVEYRLLKQGEEFTIARVKDEKLEVGVFFVDASDESDVDIGGIRCNWRMDDGKMERCQKTSLLYKQGHIAYNHSTTTTSLYLNEPIGLHPKIMIDLTDFEERPKCMYLMHLQLPLELFIDKFQSSPLLLFGEDDLELPEYSLRDKAWGSESIFELKAGTMNEVTLHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKGLGYESLFTDDTTFRHLNSTTLLVPIPRPDTKDYSKIKNGTLLCLLISIIYIFSKVFGNNKKKRSVKRE

47.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PBN1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here