Required for the maintenance of centromeric cohesion during interkinesis, until meiosis II (PubMed:24206843, PubMed:26272661). Required for regular configuration and segregation of sister chromatids in meiosis II (PubMed:24506176). Also required for centromere cohesion during meiosis I (PubMed:26272661). Involved in spindle organization at the end of telophase I and in meiosis II (PubMed:24506176). Required to prevent precocious release of pericentromeric cohesins during meiosis, but not for cohesion establishment and monopolar orientation of kinetochores at meiosis I (PubMed:24206843). Involved also in somatic development (PubMed:24206843). Regulates mitotic cell division and ploidy stability in somatic cell types (PubMed:24506176). May be involved in the organization of microtubules dynamics (PubMed:24506176). Involved in abiotic stresses and mono- or divalent ions tolerance and may play a role in maintaining meristematic activity under saline conditions (PubMed:24134393). PANS1 and GIG1 are part of a network linking centromere cohesion and cell cycle progression through control of APC/C activity (PubMed:26272661). Regulates the number of dividing cells in root meristem and is necessary for the anaphase onset control through an APC/C-mediated pathway (PubMed:26261921). Involved in maintaining correct chromosome arm cohesion under stress conditions (PubMed:26261921).

193 amino acids

MANMNALQQMIFPDENAPIHRKKSVTAASVKSKGTVLGQKKPGGARKALNDITNKSGIHAKAAASSKNKQIASAAVKEIDIAGERFLHDHSKCIKEQQNLWDDHYSADLMLLHHGSSIKEKHLNWDIEKMDAKDDLTYEEPEEMASPKFSDWLKNSTPWRSPIRHGSMMPSTPLAWRFDSCEFTLKEDSDDLF

21.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PANS1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here