Try expressing YOS9 in cell-free | Protein OS-9 homolog
Description
Lectin involved in the quality control of the secretory pathway. As a member of the endoplasmic reticulum-associated degradation lumenal (ERAD-L) surveillance system, targets misfolded endoplasmic reticulum lumenal glycoproteins for degradation (By similarity).
Family
Belongs to the OS-9 family.
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Length
457 amino acids
Sequence
MIFLPVTSVVFAISWIYSGVSAFNPYSSTPYSLKYVDEQEFLSVIDNETLLQEGRLFRPYEGSDVLCYQRNTSSLIQHHEEDTFNSEGALIEAVNMVNAILAPNPIEMNTVPISYWTYIISSGETRTVVQKGYFGETYLLGNSSNYNSTIDYHFAKSKTGRVYLSETLVDGCTCDLTHKPREVEIQYICPKRPLSRPFHLEVREIQSCKYQLRLFLPQLCELSSFNPLLGQLSEHNIICHRSGSKLSPALDIFNRYSATVLDHGIYLLKPKNSAKDRRQLMYHAAEPLDSQTTLFELTVEERFIGDFISSLKKLIGSDFIQSPTGKSIKPGDLFLWRAPVVDETGNLLFLIDLELNSASEAIGKVNNDASLLNELPIHNMVYFDSMTVNQTDETSSNSLPEKSTGLVPDIFATDEIESPYKGGTAQELKDKLMEAFRDIGYPDIEVEILEEVVEEQN
Mass
51.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing YOS9 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.
Order Here