Description
Lectin involved in the quality control of the secretory pathway. As a member of the endoplasmic reticulum-associated degradation lumenal (ERAD-L) surveillance system, targets misfolded endoplasmic reticulum lumenal glycoproteins for degradation (By similarity).
Family
Belongs to the OS-9 family.
Species
Candida albicans (strain SC5314 / ATCC MYA-2876)
Sequence
MNWTSLVYLWFIFKSIFADLTSHQLKSKVVFLDTTISDEVARSYLGSEDGNVTHGNYEILSIANGANDGNITSYLCQLPRTKKMAPTKPKPTMSVHELKSRAIDLISESFVEGTSCVFSFNLHANYWTIGYCHGINVIQFHENLDDFISGIHKPHSPNHVYTLGNFSKQTSPLEFEFDTKERTISQRLLGEVCDLTGEPRTIDTIYRCDHILEIVELTEIRTCQYELHINVPKLCSLPEFKRTNLEEGVSEILCTRIE
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing YOS9 in a
cell-free protein expression systems? We have solved
cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.
Order Here