Description
Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position. Does not deaminate acetylated N-terminal glutamine. With the exception of proline, all tested second-position residues on substrate peptides do not greatly influence the activity. In contrast, a proline at position 2, virtually abolishes deamidation of N-terminal glutamine.
Family
Belongs to the NTAQ1 family.
Sequence
MNEESASSEYKVITPSGNQCVYTSCYCEENVWKLCEYIKNQRHCPLEEVYAVFISNERKKIPIWKQKSSRGDEPVIWDYHVILLHASKQGPSFIYDLDTILPFPCSLDVYSMEAFQSDKHLKPAYWRKLRVIPGDTYLKEFASDRSHMKDSDGNWRMPPPAYPCLETPESKMNLDDFICMDPRVGYGEVYSLSDFVKHFGVK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service