Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation (PubMed:30117535). Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule (PubMed:30117535). Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position (PubMed:30117535). Involved in immune response (PubMed:30117535). Controls the expression of specific defense-response genes, activates the synthesis pathway for the phytoalexin camalexin, and influences basal resistance to the hemibiotroph pathogen Pseudomonas syringae pv tomato (Pst) (PubMed:30117535).

Belongs to the NTAQ1 family.

221 amino acids

MSGVTSEPIAMDATRFQHTPYYCEENVYLLCKTLCENGVAEATCSDLFVVFISNEKKQVPLWHQKASTRADGVVLWDYHVICVQRKKESDSEPLVWDLDSTLPFPSPLASYVTETIQPSFQLFAEYQRFFRIVHAPLFFKHFASDRRHMKEPDGSWTAQPPPYEPIVAQDGILHNLSEYIAMSGADTLSSLDPETVTAAISQKLGVVVSHTQLQDLFTKLP

25 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NTAQ1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here