Interferes with TCR signaling from the cell membrane. Interacts with CD247/TCRZ (TCR zeta chain) and exert potent down-regulation of cell surface TCR/CD3 complexes (By similarity).

Belongs to the lentivirus primate group Nef protein family.

230 amino acids

MGLGSSKPQHKKQLTIWRALHATRHTRYGLLADPLIGQSSTLQEECDKGLRKSLIRKRNGNMTPEGRRLQDGDQWDEWSDEEDEVGFPVRPRVPLRQITYKLAVDFSHFLKEKGGLDGIYYSDRRNKILNLYALNEWGIIDDWNAWSKGPGIRYPRCFGFCFKLVPVALHEEAETCERHCLVHPAQLHEDPDGINHGEILAWKFDPMLAVQYDPSREYFTDLYSTVGTGN

26.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nef using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here