Required for mitosis progression. Promotes the nucleation of microtubules from the spindle (By similarity). May play an important role during the embryonic development and differentiation of the central nervous system (PubMed:1378265).

660 amino acids

MQENLRFASSGDDVKIWDASFLTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVDLNSTSMYLASGGLNNTVNIWDLKSKRLHRSLKDHKCEVTCVAYNWNDCYIASGSLSGEIILHSVTTNTSSTPFGHGSKQPIRHIKYSLFRKSLLGSVSDNGVVTLWDVNSQSSYHTFDSTHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTSLTKASLSKGSSNKATAVNKRSVPVSSSSGAAQNSGIVREAPSPSIATVLPQPVTTALGKGSGAAQDEAGLARSKSTDIFSKETDAGKSQDFSSFDDTGKNSLGDMFSPIRDDAVVSKGGDESIGKGDGLDFLPQLNSVFPLRKNAGASSSLVLHSSPLNVLMGSSGKEENESHEPSAESKRAYLGKQEPKDAMKQFTKLISSGAEPGILNTCPSSNQARNLEKFEKPEKDIEAQLIHEPSVNGSSTTVPKAASSVTAGVASSLSEKIVDTLGNSRPGAPLTSVQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHIQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF

71.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Nedd1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here