Plays a role in inducing apoptosis and is involved in the repair of head patterning defects in the embryo caused by extra maternal copies of the homeotic gene bicoid.

206 amino acids

MEHHQIYRHKKFDMGRKIEKCDLQLKEELISRSGTPCTSRSPFDAANQSVSLGFSDQDADFPPLPKRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNMVRKFPKKERSPKDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSSRRVPEENTKSNFSIDYLIGGIKQEHA

24 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mabi using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here