Protein expression services for MCD1 | Protein MULTIPLE CHLOROPLAST DIVISION SITE 1
Description
Required for chloroplast division. Regulates FtsZ ring positioning in chloroplasts. Determines the site of chloroplast division in concert with MIND1. Not directly involved in ring formation, but probably required for MIND1 localization to regulate FtsZ ring formation.
Species
Arabidopsis thaliana
Length
349 amino acids
Sequence
MASIDSLQFHSLCNLQSSIGRAKLQNPSSLVIFRRRPVNLNWVQFETKGSFVCKAIGDSSTPDEDIQNTQSDDNVVVVTATTQSDIPHDSEYSISRFRSMVTTLPPVVFLMKKCSVNSIWIGVCITATVLVAAIRAYVVRKSRDNQRAGSVADLVRRGQLRSGDRRGISKSLNYEDPFNNPFVKLDKGSSTVEMCGKVYRLAPVTLTEKEQTIHQKRRSRAYQWKRPTIFLKEGDSIPPDVDPDTVRWIPANHPFATTVSDIDQDLAQNNVYQKQGVPFRIRAEHEAMQKKLEALQNEEKLNNLSIDSQNARDFQRPYKFSAKLEGENIQKNSQENHTGNSSSEETHKS
Mass
39.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MCD1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here