Prevents the establishment of cellular antiviral state by blocking the cellular IRF7-mediated innate immunity. May also inhibit viral replication by modulating BRLF1 activity (By similarity).

Belongs to the epstein-barr virus LF2 family.

236 amino acids

MAEAYPGGAHAALASRRSSFRNSLRRLRPTEKPDTSFMRGVWKYEIFPSYVRVTNKQVLQLDAQCQELPPCPSVGQILSFKLPSFSFNTTTYGSRYFTVAFLFFGAEDNEVFLKPFFVMHSAPGHRAKRPESAQPVHREREVYLVHCAHQIGQEPLPLPADSARAERHSADTLLHPERGQAKHQRAPDLPQWLSRHQPGRVPALPAGAAHAPISKVIRPYSHIPGEGMSGQRHTPR

26.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make LF2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here