May subvert the host innate immune response by interacting with host IL1B and interfering with its function.

Belongs to the asfivirus L83L family.

83 amino acids

MDTSLKNNDGASEADNKNYQDYKDESGNINDVINAIKHNSMVDCCHKNYSTFSSEWYMNERKYDDIAEGPSPKKSVVHRCTII

9.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mal-003 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here