Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell (By similarity).

Belongs to the chordopoxvirinae L1 family.

243 amino acids

MGAAASIQTTVTTINKKISEKLEQTASASATANCDINIGNIIFKKNKGCNVLVKNMCSANASAQLDAIVSAVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAVINNIINVQSLEVDECSAPPGQIMTFEFINTGTATGNCAMKSVLDVLTKSSDRVSGNQSTGNDFSKYLYIIGGIICFLILLYYAKKLFFMSTNDKVKVLLAKKPDVHWTTYIDTYFRSSPVLV

26.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV128 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here