Repressor for the transcription of certain pIJ101 promoters, including those the from kilA and kilB loci.

80 amino acids

MTQKTPGEIRAEAEAALKPLGQQRINVLAELDEIEKDVRPLIAEAVRMEVPYRRINEVTAVAPNTARAWAKAEAEKGSGS

8.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make korB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here