Late protein which is a part of a large complex required for early virion morphogenesis. This complex participates in the formation of virosomes and the incorporation of virosomal contents into nascent immature virions. J1 protein is required for DNA packaging during immature virions (IV) formation (By similarity).

Belongs to the chordopoxvirinae J1 family.

148 amino acids

MAHPHQHLLTLFLTDDNGFYSYLSEKSDDEALEDINTIKKYMDFILSVLIRSKEKLENIGCSYEPMSESFKALIKVKDDGTLVKAFTKPLLNPHSEKIVLDRGYTSDFAISVIRLSSKSSYILPANTKYINPNENMYINNLISLLKRN

17 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV133 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here