Acts as a specific nuclear import carrier for hsp70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound hsp70 proteins into the nucleus. hsp70 proteins import is required to protect cells from heat shock damages (By similarity).

Belongs to the OPI10 family.

197 amino acids

MFGCLVAGRLVQTDAQQVAEDKFVFNLPDFESINHVVVFMLGTVPFPERMGGSVYFSFPDQTGMPVWTLLGFITNEKPSAIFKISGLKSGEGSQHPFGTMNLPQTPSVAQIGISVELLEQMAQQTPVANAAVSTVDSFTQFTQKMLDNFYNFATSFAVSQAQMIPNPSEVFIPSNVVLKWYENFQRRMAQNPFFWKT

22 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hikeshi using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here