Description
Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus (By similarity).
Family
Belongs to the OPI10 family.
Sequence
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service