Involved in induction of the so-called NTR enzymes in response to nitrogen deprivation, as well as in glutamate biosynthesis. May mediate the glutamate-dependent repression of the GLT operon.

To E.coli YhcF.

254 amino acids

MFFKKNLTTAAICAALSVAAFSAMATDSTDTELTIIGEYTPGACTPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNITCTAPTLIAVTSKDNRQSTIVALNDTSYIEKAYDTLVDMKGTKNAFGLGSAPNGQKIGAASIGIDRSNGGIHAADDTGEIPVDLIQTDHWSAATPTWKASSNGAFCSLTSCSAIERGYSVAKTGELTPVAITAVTFPLLIDAAVNDNTILGSDETIKLDGNVTISVQYL

26.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gltF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here