Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism. Stimulates amino acid export by activating nonselective amino acid facilitators.

Belongs to the GLUTAMINE DUMPER 1 (TC 9.B.60) family.

97 amino acids

MSLHRDSMVPVNSRLENMDSPILSKICAWGVMLGLFALSLFAMAYACYHKQTSNSCIEEKQGKKQVLKPLDMEPKIVVIMAGNENPTFFAKPTQINA

10.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GDU7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here