Minor component of K99 fimbriae. Is not required for binding of K99 fimbriae to the ganglioside receptor. May play a role in initiation, elongation and flexibility of the fimbriae.

333 amino acids

MKNKYNLLFFLFLLCYGDVALAACTGKLKISPGYSGHTYSFDSSIPNNSNIARYLVEISEKIVCDADQSGWDGKRYAQLHLYSSGALCESVSGDGITFRSNVSGLSWRFPNGIPYHCAAGQINLGGIKYADRNGKVTWNPGELRHEIFLRVDNRFDFSKSRTFSVNTISGRGGLGGDSSVVIPLIGSSFNYSYSNIATCTLTGPSEVNFNTVTTSDVLKGTTHRDLNLRAECRNRGASLGLNFKFEPQYKDVSANKQGVFYAKNTSGSLTYKLTKKADASAIPLNEFVKLIVEDKVNIHTGNTIPLLLTLQKGDGKIATGKIETFLNVTMEHM

36.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fanF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here