Involved in telomere length regulation and promotes fully efficient non-homologous end-joining (NHEJ) by a mechanism activated in postdiauxic/stationary phase.

Belongs to the FYV6 family.

164 amino acids

MADNPKAPTFIKEGSGDLESQRRNEQVNREVGELVTRKSLSDQLRENSKKKRQQFQRQTKEKNSFTRVSNDDLDHINKVKLDELEKLRNFSQWAESEERNRRKQLQLLQQPSTPEHTNKQVISKNDPIPTSIKVRKLKTSNGAKNALGVISKPKHKKTDRTQKK

19.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FYV6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here