About Products Protein Database Contact

Protein expression services for FYV4 | Protein FYV4, mitochondrial

Description
Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane (PubMed:25609543, PubMed:28154081). mS41 is involved in telomere length regulation and required for survival upon exposure to K1 killer toxin (PubMed:12663529, PubMed:16552446).
Family
Belongs to the mitochondrion-specific ribosomal protein mS41 family.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
130 amino acids
Sequence
MIPSRISHKFPLFLRSSLAAPKAAYRFSSTIPKPSDQVPDVDAFLNKIGRNCNELKDTFENNWNNLFQWDSKILKEKGVNIQQRKYILKQVHNYRNNRPIHEIKLGKKSFFGGERKRKAFTAKWKAENKQ
Mass
15.3 kDa
Simulated SDS-PAGE
Western blot of FYV4 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make FYV4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here