Early protein involved in early virion morphogenesis. Participates in the formation and elongation of crescent-shaped membrane precursors of immature virions in cytoplasmic factories (By similarity).

Belongs to the chordopoxvirinae L2 family.

96 amino acids

MHTFLTARLQAIEDVSNRNLSMLELILTRAIVTHWIILDLVLNLIFDSLITSFVIIYSLYSFVARNNKVLLFLLMSYAIFRFIVMYLLYIVSESID

11.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV129 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here