Mediates the export of free fatty acid from the plastids. Potentially prefers palmitic acid (C16:0) over oleic acid (C18:1) and stearic acid (C18:0). Not involved in fatty acid activation. Required for biogenesis of the outer pollen cell wall, in particular for the assembly of exine and pollen coat and for the release of ketone wax components.

Belongs to the TMEM14 family.

226 amino acids

MASQISQLACFSSTNRQFHFQSRSFPCPMIRPQSFVVKSVDGNSSETPASLSYTAEVSKPVVEKTSKPYSTVDETATNKESITEPVEEDVATQPIRAAKIHDFCFGIPYGGLVVSGGLLGFAFSRNLTSLSTGVLYGGGLLALSTLSLKIWREGKSSFPYILGQAVLSAVVFWKNFTAYSMTKKLFPAGVFAVISACMLCFYSYVVLSGGNPPPKKLKPSATSPSY

24.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FAX1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here