May play a role in microtubule organization. May play a role in cell spreading and cell migration of epithelial cells; the function may involve the AKT1 signaling pathway.

Belongs to the FAM110 family.

421 amino acids

MRALPTLDSLARMRPPLGDPRAAEDTLTPRPANKSAVERLAADRAKYVRSTLGSSRGPVSEHRVPEAPGVQHRNPIPSALAPAPVARRAIARKPLRPDSLVIYRQKCEFVRGSDADCSRVGLMKKFFQGSGKDKMAVAPETTRVADEDKTTKETEATWTKSSQAAAARPASMLPPPTPVVAVKSPAEKTRVANEDKTTKETEATWTKSSQAAAARPASMLPPPTPVVAVKSPAEKTRVANEDKTTKETEATWTKSSQAAATRPASMLPPPTPVVAVKSPALPFEVAPRVPVGCSGVQLRVSRSKGLQRSQSDLSSRYSIAKAESDTFFKYCGLDPDVVEALGRENFSAGSDCVTLKVRSVSMAASDSSFSRHSEDGLQEEELLEQVPSTTSVVERNARIIKWLFTCKKAKETPSQKLQGPA

45.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Fam110c using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here