Plays a role in cortical progenitor cell proliferation and differentiation. May promote dendritic spine development of post-migratory cortical projection neurons by modulating the beta-catenin signaling pathway.

Belongs to the EURL family.

277 amino acids

MEEEEHFVNIDLNDDNICSICKLETDTGTLSFCHVCFELSIEGISSATLLHSKSLRGHRDCFEKYHLIANQKLSRAKASHSTYEGVKRALSQRINRIIQYAQNRDSVTPENPGRWGAKQILCHTQQAGRKLVPQSDAQVPRYAPRWTEEASMVSESDYGKSMLDCHSAEELGLGLWPGERPQNREQRDSRQRRHSGHSREELMRKNVEELRQLNEQLLLQIQNVFEELSVVVQEKDSLSSELHVRHIAIEQLFKNCAKLPWLQIGRAGVKAANNPVE

31.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make eurl using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here