May be a substrate targeting component of a cullin-RING-based E3 ubiquitin-protein ligase complex RTT101(MMS1-ESC2). Involved in HMR and telomere silencing via the recruitment or stabilizing of the SIR (silent information regulators) complex (By similarity).

407 amino acids

MGEFNEYDDIDDFFCNDISPLHDEADEFGSTDIALPSQLYGKGPKPRAGESKALRDRNKESGSGTESEAKGDTLATKRGRSSWRRGASESSRSSSLGSSSPSDSSSGRSLSPVRPAKRKRTDEQQPESEANRFLAEMERDIELSAGPGGGETATGKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMDDIEDDNDDFLVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTICNIDIEDGDIIEVVVK

45.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ESC2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here