Involved in the formation of X-, Y-shaped and twinned plasmodesmata (PD), thus modelating PD size exclusion limit and regulating cell-to-cell transport (PubMed:22411811). Cell cycle checkpoint regulator that monitors and responds to DNA damage such as DNA cross-links, and triggers the halt of the cell cycle progression in the presence of DNA cross-linking agents. Mediates the active process of aluminum- (Al) dependent root growth inhibition and thus is required for response to Al toxicity. Essential for signal transduction and development of both male and female organs (By similarity).

Belongs to the plant DSE1 protein family.

375 amino acids

MSKRPAPDPVSVLRGHRASVADICFHPSNSILFSGSTDGELRIWNTVQYRTVSSAWVHSAAHGIICVAASPVLGDNKVISQGRDGTVKCWDFGGGGLSRTPLLTIKTNSYHFCKLSIAKSPSEAMKIDDLEVNEIVDGMQREEQGDQPTDSIKFKGKELIEGPKYVAIAGEQASVVEIWDVNTAERIAQLPHSSGSPSNQTPNQRGMCMAVQAFLPSESQGLLSIMAGYEDGSIAWWDLRNLGVPLTSVKFHSEPVLSLCIDGSCKGGLSGAADEKILMFALDHSMGSCLIRKEIVLERPGIAGTSIRPDGKIAATAGWDHRVRIYNYRKGKPLAILKYHNATCNTVSFSADSKLLASASEDTTVALWELYLPRT

40.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DSE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here