The cotJ operon proteins affect spore coat composition. They are either required for the normal formation of the inner layers of the coat or are themselves structural components of the coat.

82 amino acids

MKDMQPFTPVKSYTPFHSRFDPCPPIGKKYYRTPPNLYMTFQPEHMEQFSPMEALRKGTLWKDLYDFYENPYRGGDAHGKKG

9.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cotJA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here