Involved in thiol transport from the plastid to the cytosol. Transports probably both glutathione (GSH) and its precursor, gamma-glutamylcysteine (gamma-EC). Exhibits some functional redundancy with CLT1 in maintaining the root GSH pool.

Belongs to the CRT-like transporter family.

452 amino acids

MATTSRRFTTGLFASITSVKSHSANRPQSISLIRRNHIDHRLPLIVPSSRRWIIQAARSWDGFDDGAEAEIKKPGAYGYAIGDNEIEGSSSSTVHVIDGEHVKTAEIVIWAAVTAAFGVGNRVMYKLALVPLKEYPFFLAQLSTFGYVAVYYTILYFRYRAGTVTDAMLSVPKSPFLIVGILEALAAAAGMAAAANLSGPSTTVLSQTFLVWQIFFSIIFLGRRYSVNQILGCTLVALGVIVSVASGSGAAHSLNEAGVLWILLMVLSFLLQGAGTVLKEVIFIDSQRRLKGASLDLFIVNSYGSAFQAICIALLLPFLSKLWGIPFNQLGTYLKDGAVCFLNNGTITKGCDGAPFLPLLFVIMNIGYNIALLRLLKISSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPKGFMGGTIILVLGMILYSWTPHGANSSHTDSVIPSPPPT

48.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CLT3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here