Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity). Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (PubMed:25465408).

Belongs to the plant CAR protein family.

185 amino acids

MEDKPLGILRVHVKRGINLAIRDATTSDPYVVITLANQKLKTRVINNNCNPVWNEQLTLSIKDVNDPIRLTVFDKDRFSGDDKMGDAEIDFRPFLEAHQMELDFQKLPNGCAIKRIRPGRTNCLAEESSITWSNGKIMQEMILRLKNVECGEVELMLEWTDGPGCKGLGREGSKKTPWMPTKRLD

21.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CAR9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here