Bet counteracts the innate antiretroviral activity of APOBEC3 family defense factors by inhibiting their incorporation into virions. May be implicated in the establishment and/or maintenance of viral persistance. Bet is required for viral replication (By similarity).

490 amino acids

MDSYQEEEPVASTSGLQDLQTLSELVGPENAGEGDLVIAEEPEENPRRPRRYTKRDVKCVSYHAYKELEDKHPHHIKLQDWIPKPEEMVAQKVQNQDVGTILSFDVTCLKSITSLGRNDPGNDPSIMSHVLPVVTPWPMSQDHYAPTLFGLLDRYYKGYLENPATFQTWKFTCQEDPSGKRYMGTQFWVPPLGQVNIQFYKNYQIVTCCQALDPFANIFHGTEEEMYDIDSGPDVWCTPSLCFKVIYEGAIGQKQEQKSWLCRLGYGHRMGANDYRRVDLYAMKQGKKNPYGDKGDAALQYAYQVKRGCKAGCLASPVLNFKALQFHRTLMADLTNPKIGQGYLAHGYHAAMEAYGPQRGSSEERVWWNATRNQGKKDEYYREGGEEPHYPNTPAPHKKTWEERHKVLKLSPFATPSDIQRWTTRALPYGWKVIDGNGDDYTSRRNIRTLTEMTQEEIRKRWERGYCDPFIDSGSDSDGPLSKPQTVKVW

56.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bet using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here