About Products Protein Database Contact

Try expressing BBR in cell-free | Protein Barley B recombinant

Description
Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Positively regulates the homeotic gene BKN3.
Family
Belongs to the BBR/BPC family.
Species
Hordeum vulgare
Length
350 amino acids
Sequence
MDDDGSLSIRNWGFYETMKGNLGLQLMPSVTGGHRDTKPLLPNGTFLQHHTPPHHPPHSHHPRDYGNGEPSGGMPAEPPAIHMDFVRNEAWMHPSQHQHQHQHQHQHQHQHQHQLQHQHQHQHSRELKVLNAVPVGPAPHIGHPGHAVHHHPTGFGMMPDARGAHTLQMMQPQEPPVPDEEKITPPLVEDHSVVGSKPPVKKRQQGRQPKVPKPKKPKKDATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR
Mass
39 kDa
Simulated SDS-PAGE
Western blot of BBR recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing BBR in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here