Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Positively regulates the homeotic gene BKN3.

Belongs to the BBR/BPC family.

350 amino acids

MDDDGSLSIRNWGFYETMKGNLGLQLMPSVTGGHRDTKPLLPNGTFLQHHTPPHHPPHSHHPRDYGNGEPSGGMPAEPPAIHMDFVRNEAWMHPSQHQHQHQHQHQHQHQHQHQLQHQHQHQHSRELKVLNAVPVGPAPHIGHPGHAVHHHPTGFGMMPDARGAHTLQMMQPQEPPVPDEEKITPPLVEDHSVVGSKPPVKKRQQGRQPKVPKPKKPKKDATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR

39 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Have you tried producing BBR in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here