V-SNARE binding protein that facilitates specific protein retrieval from a late endosome to the Golgi. Modulates the rate of arginine uptake. Involved in pH homeostasis. Required for the correct localization of IST2. May be involved in ion homeostasis together with IST2.

410 amino acids

MFSIFNSPCVFEQLPSFSQPLHSRYFDCSSPVSYYPECKRRKAIKANLRAPKKSDANCSEPLRYALAETPNGYTLSLSKRIPYELFSKYVNEKLGELKENHYRPTYHVVQDFFGNQYYVEDEADEDALLRSALKDLDFRAIGKKIAKDLFQDYEIELNHRGDELSILSKKDKIFKEFSLDQVFEDVFVIGCGVENIDDGSREKYALLKIGLVKHEEEISEGGINEPKMPIIESKIDESHDDVNMSESLKEEEAEKAKEPLTKEDQIKKWIEEERLMQEESRKSEQEKAAKEDEERQKKEKEARLKARKESLINKQKTKRSQQKKLQNSKSLPISEIEASNKNNNSNSGSAESDNESINSDSDTTLDFSVSGNTLKKHASPLLEDVEDEEVDRYNESLSRSPKGNSIIEEI

47.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BTN2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here