Plays an essential role in budded virion (BV) and occluded derived virion (ODV) development. Participates in intranuclear microvesicle formation, ODV envelopment, and subsequent embedding of virions into occlusion bodies.

84 amino acids

MNLYLLLGALAIFSLVYDKKENSIFLYLLILFLVFIIVSPAIISKNTESTVEDIPSHKAKSVRKKLEIEQALDAILNKNTSSID

9.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ac76 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here